PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001270-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 320aa    MW: 36697.2 Da    PI: 6.7131
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001270-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-172067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++++ +G g+W++ a+  g++Rt+k+c++rw++yl
    NNU_001270-RA 20 RGPWTVEEDTLLIHYIACHGEGRWNLLAKSSGLKRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding54.62.4e-1773116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    NNU_001270-RA  73 RGNLTPEEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8771567IPR017930Myb domain
SuperFamilySSF466893.8E-3118114IPR009057Homeodomain-like
SMARTSM007172.0E-141969IPR001005SANT/Myb domain
PfamPF002491.2E-152067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-232174IPR009057Homeodomain-like
CDDcd001676.00E-112267No hitNo description
PROSITE profilePS5129426.33168122IPR017930Myb domain
SMARTSM007177.2E-1672120IPR001005SANT/Myb domain
PfamPF002493.1E-1673116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2475121IPR009057Homeodomain-like
CDDcd001672.63E-1277116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSTPKNAAYG YGEEDAELRR GPWTVEEDTL LIHYIACHGE GRWNLLAKSS GLKRTGKSCR  60
LRWLNYLKPD VKRGNLTPEE QLLILELHSK WGNRWSKIAQ HLPGRTDNEI KNYWRTRVQK  120
QARHLKIDAN SMMFRDAIRC FWMPRLLQKM EESSSAMKTQ NSSTPPSTPL NQTSQASALP  180
PPPPPPPPLE GSLRISKAIN SFDHEKNSNP GNYCTSPSIF SSDSMMSISK FPEISDYPAT  240
SLHNFDNSDY NPFLRSSFYV DNCGSYDMDD FNMSAMSVMG GYETSDCHMA ESNWAYDDMA  300
ESIWNIDELW QFRKLQDRNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-26171211104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264231.10.0PREDICTED: transcription factor MYB108-like
TrEMBLD7SJ031e-132D7SJ03_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g03560.t011e-132(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-86myb domain protein 62